PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.KM0ZG
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 143aa    MW: 16571.5 Da    PI: 8.4045
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.KM0ZGgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM118.85e-3781221128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 
                  lppGfrF Ptdeelvv++L++k++  +++  +vi+++d+y+++Pw+L+     e ++wy++s+r         +nr+t++gyW+  g +++v+s+ ++
  Araip.KM0ZG   8 LPPGFRFYPTDEELVVHFLQRKAALLPCHP-DVIPDLDLYSFDPWELD-----EGNQWYYYSRRT--------QNRVTANGYWNPMGIEEAVVSNsSN 91 
                  79*************************999.99**************8.....779******984........58*****************998677 PP

          NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                  + vg+kk  vfy g+ap+g++t+W+m+eyrl
  Araip.KM0ZG  92 RRVGIKKFYVFYVGEAPHGNRTNWIMQEYRL 122
                  78***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.8E-446128IPR003441NAC domain
PROSITE profilePS5100542.4988143IPR003441NAC domain
PfamPF023651.6E-229122IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 143 aa     Download sequence    Send to blast
MGDSNVNLPP GFRFYPTDEE LVVHFLQRKA ALLPCHPDVI PDLDLYSFDP WELDEGNQWY  60
YYSRRTQNRV TANGYWNPMG IEEAVVSNSS NRRVGIKKFY VFYVGEAPHG NRTNWIMQEY  120
RLSDSAASSS RSSTKRKSQP KTL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-36412213142NO APICAL MERISTEM PROTEIN
1ut4_B3e-36412213142NO APICAL MERISTEM PROTEIN
1ut7_A3e-36412213142NO APICAL MERISTEM PROTEIN
1ut7_B3e-36412213142NO APICAL MERISTEM PROTEIN
3swm_A3e-36412216145NAC domain-containing protein 19
3swm_B3e-36412216145NAC domain-containing protein 19
3swm_C3e-36412216145NAC domain-containing protein 19
3swm_D3e-36412216145NAC domain-containing protein 19
3swp_A3e-36412216145NAC domain-containing protein 19
3swp_B3e-36412216145NAC domain-containing protein 19
3swp_C3e-36412216145NAC domain-containing protein 19
3swp_D3e-36412216145NAC domain-containing protein 19
4dul_A3e-36412213142NAC domain-containing protein 19
4dul_B3e-36412213142NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016193641.15e-89PREDICTED: NAC domain-containing protein 104-like
SwissprotQ8GWK63e-58NC104_ARATH; NAC domain-containing protein 104
TrEMBLA0A0B2S4H52e-74A0A0B2S4H5_GLYSO; NAC domain-containing protein 68
TrEMBLI1KR612e-74I1KR61_SOYBN; Uncharacterized protein
STRINGGLYMA08G08010.15e-74(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17363395
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64530.15e-58xylem NAC domain 1